Description | Mediator of RNA polymerase II transcription subunit 19 (Fragment) |
Sequence | GTTELTGSTNLITHYNLEHAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPICGSSFTPLTGTMLTGFRLHAGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKK |
Length | 150 |
Position | Head |
Organism | Nipponia nippon (Crested ibis) (Ibis nippon) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Pelecaniformes> Threskiornithidae> Nipponia. |
Aromaticity | 0.04 |
Grand average of hydropathy | -1.273 |
Instability index | 62.13 |
Isoelectric point | 9.90 |
Molecular weight | 17083.61 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP01708 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 71.55| 14| 17| 118| 131| 1 --------------------------------------------------------------------------- 99- 112 (23.63/ 9.28) PKKKNKHKHKQSRT 118- 131 (24.32/ 9.74) PETPSDSDHKKKKK 137- 150 (23.59/ 9.26) PERKRKKKEKKKKK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) CRLMHIQPPKKKNKHKHKQS 2) DSDHKKKKKKKEEDPERKRKKKEKKKKK | 91 123 | 110 150 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab