<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01706
| Description |
Mediator of RNA polymerase II transcription subunit 22 (Fragment) |
| Sequence | IEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAINQRNQQLRSLQEECDKKLIALRDEISIDLYELEEEYYSSSYSLCDGNDLPLCEAYWRQDFSTLSPESLSMPLTAATAEQSVATSQSSTPSHPHVNGHGAGPTEHS |
| Length | 162 |
| Position | Head |
| Organism | Nipponia nippon (Crested ibis) (Ibis nippon) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Pelecaniformes> Threskiornithidae>
Nipponia.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.613 |
| Instability index | 66.08 |
| Isoelectric point | 4.47 |
| Molecular weight | 18122.67 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP01706
No repeats found
No repeats found
|