<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01694
Description |
Cyclin-dependent kinase 19 (Fragment) |
Sequence | LQLLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRASKANKKPMQLPRSMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPFHHDQLDRIFSVMGFPADKDWEDIRKMPEYPTLQKDFRRTTYANSSLIKYMEKHKVKPDSKVFLLLQKLLTMDPTKRITSEQALQDPYFQEDPLPTSDVFAGCQIPYPKREFLNEDEPEEKGDKQNSTQTNGTAGGAGAGAGGAGTGLQHSQDSSLNQVPPNKKPRIGPSGANSGGPVMPSDYQ |
Length | 364 |
Position | Kinase |
Organism | Egretta garzetta (Little egret) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Pelecaniformes> Ardeidae> Egretta.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.499 |
Instability index | 46.72 |
Isoelectric point | 8.55 |
Molecular weight | 41317.86 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP01694
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.34| 21| 40| 281| 301| 1
---------------------------------------------------------------------------
281- 301 (38.76/22.86) AGCQIPYPKREFLNEDEPEEK
324- 344 (36.58/21.22) AGTGLQHSQDSSLNQVPPNKK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 86.64| 27| 40| 211| 243| 2
---------------------------------------------------------------------------
211- 243 (37.66/42.59) PTlqkdfRRTTYANSSLIKYMEKHKVkPDSKVF
254- 280 (48.98/34.12) PT.....KRITSEQALQDPYFQEDPL.PTSDVF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.44| 15| 37| 85| 99| 3
---------------------------------------------------------------------------
85- 99 (26.77/15.23) DLKPANILVMGEGPE
123- 137 (28.67/16.72) DLDPVVVTFWYRAPE
---------------------------------------------------------------------------
|