<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01690
Description |
Mediator of RNA polymerase II transcription subunit 22 (Fragment) |
Sequence | IEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAINQRNQQLRSLQEECDKKLIALRDEISIDLYELEEEYYSSSYSLCDSNDLPLCEAYWRQDFATLSPESLSVPLTAATAEQSVATSQSSTPSHPHVNGHGAGPTEHS |
Length | 162 |
Position | Head |
Organism | Egretta garzetta (Little egret) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Pelecaniformes> Ardeidae> Egretta.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.585 |
Instability index | 66.27 |
Isoelectric point | 4.47 |
Molecular weight | 18104.63 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP01690
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.78| 18| 19| 91| 108| 1
---------------------------------------------------------------------------
91- 108 (33.98/21.72) EEYYSSSY.SLC.DSNDLPL
110- 129 (22.80/12.56) EAYWRQDFaTLSpESLSVPL
---------------------------------------------------------------------------
|