Description | Mediator of RNA polymerase II transcription subunit 28 (Fragment) |
Sequence | PNNTLVDELEASFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDVARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKEALIQKHLSKLRHWQQVLEDISVQHKKPAEMPQGPLAYLEQASANIPAPMKQT |
Length | 139 |
Position | Head |
Organism | Calypte anna (Anna's hummingbird) (Archilochus anna) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Caprimulgimorphae> Apodiformes> Trochilidae> Calypte. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.594 |
Instability index | 56.20 |
Isoelectric point | 5.23 |
Molecular weight | 15961.93 |
Publications |
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP01657 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) LAYLE 2) RKEALIQKHLSK | 122 85 | 126 96 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab