<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01657
| Description |
Mediator of RNA polymerase II transcription subunit 28 (Fragment) |
| Sequence | PNNTLVDELEASFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDVARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKEALIQKHLSKLRHWQQVLEDISVQHKKPAEMPQGPLAYLEQASANIPAPMKQT |
| Length | 139 |
| Position | Head |
| Organism | Calypte anna (Anna's hummingbird) (Archilochus anna) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Caprimulgimorphae> Apodiformes>
Trochilidae> Calypte.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.594 |
| Instability index | 56.20 |
| Isoelectric point | 5.23 |
| Molecular weight | 15961.93 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP01657
No repeats found
No repeats found
|