<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01646
| Description |
Mediator of RNA polymerase II transcription subunit 19 (Fragment) |
| Sequence | GTTELTGSTNLITHYNLEHAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPICGSSFTPLTGTMLTGFRLHAGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPEHPGVGGSQASSSS |
| Length | 169 |
| Position | Head |
| Organism | Calypte anna (Anna's hummingbird) (Archilochus anna) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Caprimulgimorphae> Apodiformes>
Trochilidae> Calypte.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.275 |
| Instability index | 65.21 |
| Isoelectric point | 9.90 |
| Molecular weight | 18943.47 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP01646
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 79.46| 16| 16| 118| 133| 1
---------------------------------------------------------------------------
99- 114 (26.45/11.63) PKKKNKHKHKQSRTQD
118- 133 (26.61/11.74) PETPSDSDHKKKKKKK
137- 152 (26.40/11.60) PERKRKKKEKKKKKNR
---------------------------------------------------------------------------
|