<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01626
Description |
Transcription elongation factor A protein 2 (Fragment) |
Sequence | GAMDLLKELKSMPMTLDLLQSTRIGMSVNALRKQSTDEEVISLAKSLIKSWKKLLDASEEKNEEKKKSQSLPTSSSKETGNSRDQSFSFSSNKRQEPPKTPTTPKITTFPPAPITCDAVRNKCREMLTAALQADDDYVAIGADCEHIAAQIEECSLTALVRIYQDVKNTDMKYKNRVRSRISNLKDSKNPELKKNVLCGVITPEQIAVMTSEEMASNELKEIRKAMTKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRSSDEPMTTFVVCNECGNRWK |
Length | 285 |
Position | Unknown |
Organism | Cuculus canorus (common cuckoo) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Cuculiformes> Cuculidae> Cuculus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.698 |
Instability index | 55.46 |
Isoelectric point | 8.90 |
Molecular weight | 31946.28 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | translation elongation factor activity GO:0003746 IEA:UniProtKB-KW
zinc ion binding GO:0008270 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP01626
No repeats found
|