| Description | Mediator of RNA polymerase II transcription subunit 19 (Fragment) |
| Sequence | GSTNLITHYNLEHAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPICGSSFTPLTGTMLTGFRLHAGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPEHPGVGGSQASSSSSLR |
| Length | 166 |
| Position | Head |
| Organism | Cuculus canorus (common cuckoo) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Cuculiformes> Cuculidae> Cuculus. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.294 |
| Instability index | 68.39 |
| Isoelectric point | 10.01 |
| Molecular weight | 18697.26 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP01625
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 85.89| 27| 113| 21| 50| 1
---------------------------------------------------------------------------
21- 50 (44.98/25.08) KKVKEKLSN.FLPDLPGmidLPGSH..DNSSLR
137- 166 (40.90/16.81) KKEKKKKKNrHSPEHPG...VGGSQasSSSSLR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.10| 14| 17| 92| 107| 2
---------------------------------------------------------------------------
92- 105 (25.66/16.65) PPKKKNKHKHKQSR
111- 124 (25.44/ 9.43) PPETPSDSDHKKKK
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) MHIQPPKKKNKHKHK 2) SDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPEHPG | 88 118 | 102 153 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab