Description | Mediator of RNA polymerase II transcription subunit 18 (Fragment) |
Sequence | GSVLDQSLESLLHRLRGLCDNMEPETFLDHEMVFLLKGQQASPFVLRARRSMDKSGMPWHLRYLGQPEIGDKSRHALVRNCVDIATSDNLTDFLVEMGFRMDHEFVAKGHVFRKGIMKIMVYKIFRILMPGNTESIEPLSLSYLVELNVVAPAGQDVVSDDMRNFAEQLKPLVHLEKIDPKRLM |
Length | 184 |
Position | Head |
Organism | Cuculus canorus (common cuckoo) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Cuculiformes> Cuculidae> Cuculus. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.161 |
Instability index | 44.42 |
Isoelectric point | 6.41 |
Molecular weight | 21066.33 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP01615 No repeats found |
MoRF Sequence | Start | Stop |
1) FVLRAR 2) GMPWHLRYLGQPEI | 44 56 | 49 69 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab