<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01586
Description |
Mediator of RNA polymerase II transcription subunit 31 (Fragment) |
Sequence | LESDDTGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKEPEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNNTSVK |
Length | 125 |
Position | Middle |
Organism | Corvus brachyrhynchos (American crow) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Passeriformes> Corvoidea> Corvidae>
Corvus.
|
Aromaticity | 0.15 |
Grand average of hydropathy | -0.750 |
Instability index | 33.03 |
Isoelectric point | 8.73 |
Molecular weight | 15344.38 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP01586
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 106.11| 35| 44| 16| 59| 1
---------------------------------------------------------------------------
16- 57 (48.15/41.33) LEFVQCLanpNYLNFLaQRGYFKdKAFVN.....YL..KYLLYWKEpeY
61- 102 (57.96/24.30) LKYPQCL...HMLELL.QYEHFR.KELVNaqcakFIdeQQILHWQH..Y
---------------------------------------------------------------------------
|