Description | Mediator of RNA polymerase II transcription subunit 29 (Fragment) |
Sequence | QTLMKGAAQNLVQNSSIDNGQKSADGALQRFDKSLEEFYALCDQLELCLRLAHECLSQSFDSAKHAPALVPAAPKGEGGPGAETLPYTQYLPLIKAQIAGAKDIHNALLEGTNKITGKLPPPGGP |
Length | 125 |
Position | Tail |
Organism | Corvus brachyrhynchos (American crow) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Passeriformes> Corvoidea> Corvidae> Corvus. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.319 |
Instability index | 46.51 |
Isoelectric point | 5.88 |
Molecular weight | 13180.82 |
Publications |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP01585 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) GPGAETLPYTQYLPLIKAQIA 2) KITGKL | 79 114 | 99 119 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab