| Description | Mediator of RNA polymerase II transcription subunit 29 (Fragment) |
| Sequence | QTLMKGAAQNLVQNSSIDNGQKSADGALQRFDKSLEEFYALCDQLELCLRLAHECLSQSFDSAKHAPALVPAAPKGEGGPGAETLPYTQYLPLIKAQIAGAKDIHNALLEGTNKITGKLPPPGGP |
| Length | 125 |
| Position | Tail |
| Organism | Corvus brachyrhynchos (American crow) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Passeriformes> Corvoidea> Corvidae> Corvus. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.319 |
| Instability index | 46.51 |
| Isoelectric point | 5.88 |
| Molecular weight | 13180.82 |
| Publications |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats | >MDP01585 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) GPGAETLPYTQYLPLIKAQIA 2) KITGKL | 79 114 | 99 119 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab