Description | Mediator of RNA polymerase II transcription subunit 28 (Fragment) |
Sequence | QACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDVARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKEALIQKHLSKLRHWQQVLEDISVQHKKPAEMPQGPLAYLEQASANIPAPMKQT |
Length | 126 |
Position | Head |
Organism | Corvus brachyrhynchos (American crow) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Passeriformes> Corvoidea> Corvidae> Corvus. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.622 |
Instability index | 62.83 |
Isoelectric point | 6.34 |
Molecular weight | 14530.43 |
Publications |
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP01580 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) GPLAYLE 2) LQRKEALIQKHLSKLRHW | 107 70 | 113 87 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab