| Description | Mediator of RNA polymerase II transcription subunit 30 |
| Sequence | MEIFQLLRNMQLPNGVTYHTGTYQDRLTKLQDHLRQLSILFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKNDDRAGPPRFASDERREVAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN |
| Length | 130 |
| Position | Head |
| Organism | Fukomys damarensis (Damaraland mole rat) (Cryptomys damarensis) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Glires> Rodentia> Hystricomorpha> Bathyergidae> Fukomys. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.765 |
| Instability index | 41.26 |
| Isoelectric point | 8.58 |
| Molecular weight | 15315.45 |
| Publications |
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats |
>MDP01564
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.58| 21| 69| 29| 49| 1
---------------------------------------------------------------------------
29- 49 (35.66/18.82) KLQDHLRQLSILFRKLR.LVYD
100- 121 (32.91/16.99) KLKQKNQQLKQIMDQLRnLIWD
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) DPIPVEQLIPYVEEDGSKN 2) DRAGPPRFA 3) LFRKLRLVY | 59 79 40 | 77 87 48 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab