<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01564
| Description |
Mediator of RNA polymerase II transcription subunit 30 |
| Sequence | MEIFQLLRNMQLPNGVTYHTGTYQDRLTKLQDHLRQLSILFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKNDDRAGPPRFASDERREVAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN |
| Length | 130 |
| Position | Head |
| Organism | Fukomys damarensis (Damaraland mole rat) (Cryptomys damarensis) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Hystricomorpha> Bathyergidae>
Fukomys.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.765 |
| Instability index | 41.26 |
| Isoelectric point | 8.58 |
| Molecular weight | 15315.45 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP01564
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.58| 21| 69| 29| 49| 1
---------------------------------------------------------------------------
29- 49 (35.66/18.82) KLQDHLRQLSILFRKLR.LVYD
100- 121 (32.91/16.99) KLKQKNQQLKQIMDQLRnLIWD
---------------------------------------------------------------------------
|