<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01550
| Description |
Mediator of RNA polymerase II transcription subunit 29 |
| Sequence | MAVPQQQASAASSAAGVSGPGWAGGPGPQQQQQLPAQLAGPAQNRFLQEQQQDFDPVQSYKMLIQQLKESLQTLMKVAAQNLIQNTNVDKRQKSSKVPIQRFDKCLQEFSVLCNHPGSLPEPGT |
| Length | 124 |
| Position | Tail |
| Organism | Fukomys damarensis (Damaraland mole rat) (Cryptomys damarensis) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Hystricomorpha> Bathyergidae>
Fukomys.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.607 |
| Instability index | 67.21 |
| Isoelectric point | 8.68 |
| Molecular weight | 13440.03 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP01550
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.61| 18| 18| 15| 32| 1
---------------------------------------------------------------------------
15- 32 (36.65/15.79) AGVSGPGWAGGPGPQQQQ
36- 53 (31.96/13.00) AQLAGPAQNRFLQEQQQD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.37| 15| 18| 63| 80| 2
---------------------------------------------------------------------------
63- 77 (23.83/10.48) LIQQLK.ESLQTLMKV
82- 97 (19.54/11.67) LIQNTNvDKRQKSSKV
---------------------------------------------------------------------------
|