| Description | Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MATYTLANERLRALEDIEREIGAILQNAGTVILELSKEKTNERLLDRQAAAFTASVQHVEAELSAQIRYLTQVATGQPHEGSSYSSRKDCQMALKRVDYARLKLSDVAQTCEQMLES |
| Length | 117 |
| Position | Head |
| Organism | Fukomys damarensis (Damaraland mole rat) (Cryptomys damarensis) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Glires> Rodentia> Hystricomorpha> Bathyergidae> Fukomys. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.408 |
| Instability index | 32.26 |
| Isoelectric point | 5.40 |
| Molecular weight | 13087.64 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP01548
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.53| 24| 31| 8| 36| 1
---------------------------------------------------------------------------
8- 36 (33.02/32.32) NERLraledIEREIGAILQNAGTVILELS
41- 64 (39.51/25.86) NERL.....LDRQAAAFTASVQHVEAELS
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) ERLLDRQA 2) VQHVEAELSAQIRYLTQVATGQPHEGSSYSSRKDCQMALKRVDYARLKLSDVA | 42 56 | 49 108 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab