<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01537
Description |
Uncharacterized protein |
Sequence | MPSISEKDILDIKRRLQQMIDGHKEFVDAPELIAALESMDITIDILKRTLIGITVNELRKKSGNEALNKRMKSLVKKWKSQMETNVSKKSSNTPPPPQQSVPTIKKPTNNISKTQPQSQTFTANVKIHKDDYRNKVIGMFISAFNIAELPEGTLDPEDLAVRIEEEHFKLHTNTNDKYKAAIRSKIFNLRDKKNPDLRANVLTGVISPEKFSTMTSEDMASDAMKKQREKYTQEAIREHQMSIAEGTPSDMFKCGKCRKYNCTYTQVQTRSADEPMTTFVFCRECGNRWKFS |
Length | 292 |
Position | Unknown |
Organism | Strongyloides ratti (Parasitic roundworm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Strongyloididae>
Strongyloides.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.751 |
Instability index | 51.46 |
Isoelectric point | 9.32 |
Molecular weight | 33441.02 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | nucleic acid binding GO:0003676 IEA:InterPro
zinc ion binding GO:0008270 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP01537
No repeats found
|