<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01535
| Description |
Mediator of RNA polymerase II transcription subunit 9 |
| Sequence | MEVSGIENSSQKIVKNDPASYSKTCLTEMHAALTDLIESFEVPNSSNINKKVKNVESRLEIFKSSLNQIPDIDHNLLYQEKKIKDLRRCLELKKNLINRLYALPKKLEDIKPGKGISEILNKKPAATK |
| Length | 128 |
| Position | Middle |
| Organism | Strongyloides ratti (Parasitic roundworm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Strongyloididae>
Strongyloides.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.601 |
| Instability index | 56.00 |
| Isoelectric point | 9.30 |
| Molecular weight | 14535.72 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP01535
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.40| 12| 38| 2| 16| 1
---------------------------------------------------------------------------
2- 16 (16.50/20.34) EVSgieNSS..QKIVKN
41- 54 (17.89/11.09) EVP...NSSniNKKVKN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 33.85| 11| 21| 77| 87| 2
---------------------------------------------------------------------------
77- 87 (19.04/11.61) LYQ.EKKIKDLR
100- 111 (14.81/ 7.72) LYAlPKKLEDIK
---------------------------------------------------------------------------
|