<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01526

Description Mediator of RNA polymerase II transcription subunit 19
SequenceMEVDEVQPTITSITDKSSPQLMEMALLSTSTAEDDNDISKYSESKKIELAKKVREENKKVGEKFPGFYGVMKKPPNTQKLLGSDDILSIYNLRECFNKVCGKVNEGDSIYSILDEVIGPLENETYKSDNSSLRKLIERPPIVDKEIINFTDQMLKFYDLQPGALDKKYQLEGDAKEIASKYAMECNANGAQGKIATNGSSDRISSLNFDMYEKLDSGVRLKKKNRTKEEKEERARKKAERKEKRRLEAEKERFEEISIIKKAKKEEKFIESEKTFTVQTEQEDNEEEIIQ
Length290
PositionHead
OrganismStrongyloides ratti (Parasitic roundworm)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Strongyloididae> Strongyloides.
Aromaticity0.06
Grand average of hydropathy-0.948
Instability index47.02
Isoelectric point5.30
Molecular weight33311.28
Publications

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP01526
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.03|      18|      21|     229|     249|       1
---------------------------------------------------------------------------
  229-  247 (25.34/14.67)	EKEERAR....KKAeRKEKRRLE
  249-  270 (24.68/15.82)	EKERFEEisiiKKA.KKEEKFIE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     151.43|      38|      64|      56|      93|       2
---------------------------------------------------------------------------
   56-   93 (66.07/34.85)	ENKKVGEKFPGFYGVMKKPPNTQK.LLG.SDDILSIYNLR
   96-  114 (32.58/14.38)	FNKVCGKVNEG...................DSIYSI..LD
  121-  160 (52.78/26.73)	ENETYKSDNSSLRKLIERPPIVDKeIINfTDQMLKFYDLQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.11|      17|      25|     167|     183|       3
---------------------------------------------------------------------------
  167-  183 (28.59/18.82)	KYQLEGDAKEIAS.KYAM
  193-  210 (24.52/15.19)	KIATNGSSDRISSlNFDM
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP01526 with Med19 domain of Kingdom Metazoa

Unable to open file!