Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MEVDEVQPTITSITDKSSPQLMEMALLSTSTAEDDNDISKYSESKKIELAKKVREENKKVGEKFPGFYGVMKKPPNTQKLLGSDDILSIYNLRECFNKVCGKVNEGDSIYSILDEVIGPLENETYKSDNSSLRKLIERPPIVDKEIINFTDQMLKFYDLQPGALDKKYQLEGDAKEIASKYAMECNANGAQGKIATNGSSDRISSLNFDMYEKLDSGVRLKKKNRTKEEKEERARKKAERKEKRRLEAEKERFEEISIIKKAKKEEKFIESEKTFTVQTEQEDNEEEIIQ |
Length | 290 |
Position | Head |
Organism | Strongyloides ratti (Parasitic roundworm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Strongyloididae> Strongyloides. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.948 |
Instability index | 47.02 |
Isoelectric point | 5.30 |
Molecular weight | 33311.28 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP01526 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 50.03| 18| 21| 229| 249| 1 --------------------------------------------------------------------------- 229- 247 (25.34/14.67) EKEERAR....KKAeRKEKRRLE 249- 270 (24.68/15.82) EKERFEEisiiKKA.KKEEKFIE --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 151.43| 38| 64| 56| 93| 2 --------------------------------------------------------------------------- 56- 93 (66.07/34.85) ENKKVGEKFPGFYGVMKKPPNTQK.LLG.SDDILSIYNLR 96- 114 (32.58/14.38) FNKVCGKVNEG...................DSIYSI..LD 121- 160 (52.78/26.73) ENETYKSDNSSLRKLIERPPIVDKeIINfTDQMLKFYDLQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 53.11| 17| 25| 167| 183| 3 --------------------------------------------------------------------------- 167- 183 (28.59/18.82) KYQLEGDAKEIAS.KYAM 193- 210 (24.52/15.19) KIATNGSSDRISSlNFDM --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) ISIIKK 2) KFPGFY | 256 63 | 261 68 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab