<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01524

Description "Zinc finger, C2H2 domain and Mediator complex, subunit Med7 family and Zinc finger C2H2-type/integrase DNA-binding domain and Zinc finger, C2H2-like domain-containing protein"
SequenceMDQNQGAINISPFPLPPEYAQEYTTDNIKSGRFRYPPPIPKKYKLFGIEYDRDNDKEPSLIDLKIPQLYNSKEDIKKELKKLNMSMIAAYLDLLDVLIRCPSDPERIQRIEQLRLLFINFHHLCNQLRPIQARDNLVAICEDQVIDIRVTESLRQIVKHGKSDTYDLFKKYVKVLRDKKDKYYKKRRLFMKEKKMEQAQRKITNENNYSFIDVNSENNEQMKSLNMDNMLNETSENNSSVFTSYSNEDLNTNEYHEKDTVPNLNRNAKRMNRIKHQPYCSSSTTKRVMNPVSIRKHTSIDAECDTNTQLEEDYYYIEDNSYDQQDFVEVNEPIFNDYYRQLNVNVVTQCPECSRVFYTTDQLMLHVENCMLEAFEKEVSAIYDMYLRENQISREVHGYEETYNHNKESTTLFTQNCSEKDMINHSNLPVYQLINNFPSNNDDYENEKFFQGIKATPIDIYGKKVNEINEHITDNLCYSENIQNDTTLNTSKTQNNVSFQSREKNFQNSNLLQKHINKNINDVSLTCKSVIPVNNCDIQEKSVHLVSSSTSGITELNMDGTVKHLKKPKMECPTCGLWLYRHNFSAHFRTHTGDQPHSCPYCDKKFRTTSAQKVHVRAHTGEKPYHCMICEYASLTKRNLDRHILNNHVNTPKKQIRVRKSIYRSGKEIYDDEDISSKEDLLDVT
Length684
PositionMiddle
OrganismStrongyloides ratti (Parasitic roundworm)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Strongyloididae> Strongyloides.
Aromaticity0.09
Grand average of hydropathy-0.886
Instability index43.34
Isoelectric point6.47
Molecular weight80411.50
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
DNA binding	GO:0003677	IEA:UniProtKB-KW
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP01524
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.10|      18|      18|     215|     232|       1
---------------------------------------------------------------------------
  215-  232 (33.28/21.44)	SENNEQ.MKSL.NMDNMLNE
  234-  253 (23.82/13.09)	SENNSSvFTSYsNEDLNTNE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      91.00|      24|      25|     571|     595|       2
---------------------------------------------------------------------------
  571-  595 (48.00/35.56)	CPTCGLWlYRHNFS..AHFRTHTGDQP
  598-  623 (43.00/27.00)	CPYCDKK.FRTTSAqkVHVRAHTGEKP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.44|      16|      18|       8|      23|       3
---------------------------------------------------------------------------
    8-   23 (30.92/20.79)	INISPFPLPPEYAQEY
   28-   43 (31.52/21.34)	IKSGRFRYPPPIPKKY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.40|      17|      21|     298|     314|       5
---------------------------------------------------------------------------
  298-  314 (31.16/17.77)	SIDAE..CDTNTQLEEDYY
  320-  338 (27.24/14.68)	SYDQQdfVEVNEPIFNDYY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.01|      15|      18|     155|     170|       6
---------------------------------------------------------------------------
  155-  170 (22.24/17.96)	QIVKHgKSDTY....DLFKK
  173-  191 (20.77/11.02)	KVLRD.KKDKYykkrRLFMK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.60|      15|      18|     423|     437|       9
---------------------------------------------------------------------------
  423-  437 (27.76/16.85)	NHSNLPVYQLINNFP
  442-  456 (26.84/16.07)	DYENEKFFQGIKATP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP01524 with Med7 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MKSLNMDNMLNETSENNSSVFTSYSNEDLNTNEYHEKDTVPNLNRNAKRMNRIKHQ
221
276










Molecular Recognition Features






MoRF SequenceStartStop




1) EYAQEYTTDNIKSGRFRYPPPIPKKYKLFGIEYDRD
18
53