<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01520
Description |
Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MARFDDNTFSLRESFEENYNDIEAIVKMILNNLNSSDMGQRLVREDVSFLDLAKLLKTRENEFEDLLDKVKEFQERQEIIRNLENEVKFYDSIISNIEITFRNNVSSLLEIKDKAQNKLERMEEISNVPLDVEESVSISKCIAKSFGINNNYTWVPGSEERPYPTAAMLLNSTFGGTITI |
Length | 180 |
Position | Middle |
Organism | Strongyloides ratti (Parasitic roundworm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Tylenchina> Panagrolaimomorpha> Strongyloidoidea> Strongyloididae>
Strongyloides.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.456 |
Instability index | 50.89 |
Isoelectric point | 4.58 |
Molecular weight | 20831.21 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP01520
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.41| 13| 29| 94| 106| 1
---------------------------------------------------------------------------
94- 106 (22.05/14.39) ISNIEITFRNNVS
125- 137 (21.36/13.75) ISNVPLDVEESVS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.66| 20| 25| 43| 65| 2
---------------------------------------------------------------------------
43- 65 (28.17/27.27) VREdvsFLDLAKLLKTRENE..FED
70- 91 (30.49/20.16) VKE...FQERQEIIRNLENEvkFYD
---------------------------------------------------------------------------
|