Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSFHPQTPQSPSQFSPGTSDQNMSMSSSMTSITTALPTPAHSVNGSTLPTDASQDVVMGGDSPHKRKRAFDDLGDRQQKKVHSEGRKLGIDDLHLDVGEKYLLCRTPHPTPRPHVSEDLFELYGLGPLADSVARVLPNGEKNAIRKTYKGFIKKLGVQGHFDSVKQDPHREDSMLWLMQVPEDVWDARYVRGKDIHHGFNPEVKSKLVRATTMSKGVVPKSVWDSSVLGEIGPGKGDRAMSSARPTAPNTPLNLGGSQQPRIKVGTPVAAQDRAKRAVKKRSYGDSSFEGYGEGFPDDDTGAASGYSTGEGDMASGNKRRKKVLLHG |
Length | 327 |
Position | Head |
Organism | Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) (Pleurage anserina) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Sordariales> Chaetomiaceae> Podospora> Podospora anserina. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.747 |
Instability index | 46.44 |
Isoelectric point | 9.30 |
Molecular weight | 35525.47 |
Publications | PubMed=18460219 PubMed=24558260 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP01507 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 274.72| 87| 167| 40| 140| 1 --------------------------------------------------------------------------- 40- 140 (144.88/99.79) AHSVNGSTLPTDASQDVVMGGDSPHKRKRAFD...........DLGDRQQKKVhsegrklgiddlhlDVGEKYLLC.RTPHPTPRPHVSEDLFELYGLG.PLADS.VARVLPNGE 210- 310 (129.83/69.70) ATTMSKGVVPKSVWDSSVLGEIGPGKGDRAMSsarptapntplNLGGSQQPRI..............KVGTPVAAQdRAKRAVKKRSYGDSSFEGYGEGfPDDDTgAASGYSTGE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) SGYSTGEGDMASGNKRRKKVLLHG 2) VKKRSYGDSSFEGYGEGFPD | 304 278 | 327 297 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab