Description | Putative Mediator of RNA polymerase II transcription subunit 21 |
Sequence | MAGREVDGALSLLLTQFIAALYYNERHHDLQKFSPNDKIPELKQDQPPEVDTLDPEQFKAGQLELARDLITKEQQIEYLISTLPGLDNSERDQLQMIRELEEELGAAEQQRQEALRERDEVLKRLDGLVRLIRRH |
Length | 135 |
Position | Middle |
Organism | Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) (Pleurage anserina) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Sordariales> Chaetomiaceae> Podospora> Podospora anserina. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.760 |
Instability index | 51.48 |
Isoelectric point | 4.78 |
Molecular weight | 15730.53 |
Publications | PubMed=18460219 PubMed=24558260 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669 ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP01505 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 86.90| 27| 33| 48| 75| 1 --------------------------------------------------------------------------- 48- 75 (41.36/30.00) PEVDTLDPEQFKAGQlELARDLITKEQQ 84- 110 (45.54/28.65) PGLDNSERDQLQMIR.ELEEELGAAEQQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DGLVRLIRRH 2) DKIPELKQDQPPEVDTLDPEQFKAGQLELARDLITKEQQIEYLISTLPGLDNSERDQLQMIRELEEELG | 126 37 | 135 105 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab