<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01493
| Description |
Uncharacterized protein |
| Sequence | MATPTNGNGNLIDEFEEAFQQCLSILITKDEGLGNNGIGVSGGLTVDKEEARSEVEQVTLRFIDLARQMEAFFLQKRFLLSALKPELVVKEDINDLRVELARKEDLIKRHYDKITVWQNLLADLQGWAKSPAQGPAPNGLPNGTQSGQNQQSANGGGNTTMQQQQQILQHQQLQQQQQQLQHLQQHQMQQQLHQQQVQQGSGAPPTSGLQGVGVAVGQQGMFMTQGAVGVTGTRAGFPVAGVGSSTLQGPLAFLEKTTSI |
| Length | 260 |
| Position | Head |
| Organism | Apis mellifera (Honeybee) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.484 |
| Instability index | 50.76 |
| Isoelectric point | 5.54 |
| Molecular weight | 28218.33 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP01493
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.30| 18| 18| 162| 179| 1
---------------------------------------------------------------------------
162- 179 (34.44/13.91) QQQQQILQHQQLQQQQ.QQ
181- 199 (31.86/12.36) QHLQQHQMQQQLHQQQvQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.54| 11| 15| 202| 214| 2
---------------------------------------------------------------------------
202- 214 (16.73/11.34) GAPPTSGlqGVGV
220- 230 (20.81/ 8.82) GMFMTQG..AVGV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.91| 11| 14| 129| 139| 3
---------------------------------------------------------------------------
129- 139 (20.62/10.03) KSPAQGPAPNG
145- 155 (19.29/ 8.93) QSGQNQQSANG
---------------------------------------------------------------------------
|