<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01491

Description Mediator of RNA polymerase II transcription subunit 15
SequenceMATDENSWRTQSFRQSVIAKIDEAVQMSGMPTAKNSIEMENHVFQKAKTKEEYLGFVARLILHVRELNTKKGTGGTASGAACSGNQGMPDPIGALQTLARQGTGNNQMMNMSGPGSNPQGIIPQPPTNTATNLLQSLNQRPGQPISMQTMQNKIPGMGMMPAQTSGPMNHMGPIQTMQTNSMLTQLNPMAQGNMSQQMNQMVPNQMTQINSGQMQQNMQTQMQSQLSNQINNQITGSISGIQANLPQQMNQIAPGQLGPGQMQQQLSHMQRKQGEMINAGFPGPRNVTPTQFLGQSPSPSAPSPAGLGAPSSNQMVASPALVPSPSPQHAMMAGPQRSVGMAPSPSSSLNTPGGVGATPSPQQEDQAYRDKVKQLSKYVEPLRRMIAKMGNEGNVDKLSKMKKLLEILSNPSKRMPLDTLLKCEVVLEKVDFKRSDASVGPPVTTLKEHHFFSPLLEAVSTHLQSPVVNHTLQRTFGPCLEALFGPEIKNLPQPLKKQKIEESPSEIPDVLQGEIARLDQRFKVSLDPAQQTGSKCIQLICWLDDRHLPCVPPVSVTVPADYPLTPPRCVMAPHEYATTFLCAVQKALNARITKLPRRFSVSQLLDTWEMSVRQASAPSQIPVTASTVLMGL
Length632
PositionTail
OrganismApis mellifera (Honeybee)
KingdomMetazoa
Lineage
Aromaticity0.03
Grand average of hydropathy-0.449
Instability index54.01
Isoelectric point9.35
Molecular weight68573.14
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP01491
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.87|      18|      25|     296|     319|       1
---------------------------------------------------------------------------
  296-  313 (36.79/10.71)	SPSPSAP..SPAGLGA.PSSN
  342-  362 (27.08/ 9.02)	APSPSSSlnTPGGVGAtPSPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      66.25|      22|      25|     139|     163|       2
---------------------------------------------------------------------------
  139-  161 (39.76/14.93)	QRPGQPI.SMQTMQ........NKIpGMGMMP
  165-  195 (26.49/ 6.54)	SGPMNHMgPIQTMQtnsmltqlNPM.AQGNMS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      64.08|      19|      25|      88|     106|       3
---------------------------------------------------------------------------
   88-  106 (34.77/17.70)	MPDPIGALQTLARQ...GTGNN
  111-  132 (29.31/13.74)	MSGPGSNPQGIIPQpptNTATN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.83|      17|      26|     442|     458|       4
---------------------------------------------------------------------------
  442-  458 (31.29/21.02)	PVTTLKEHHFFSPLLEA
  466-  482 (32.55/22.15)	PVVNHTLQRTFGPCLEA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      86.95|      24|      25|     198|     222|       5
---------------------------------------------------------------------------
  198-  217 (26.01/11.16)	........MNQMVPNQMTQINSGqMQQN
  218-  244 (32.78/11.27)	MQTQMqsqLSNQINNQITGSISG.IQAN
  261-  280 (28.16/ 8.58)	QMQQQ...LSHMQRKQGEMINAG.....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.88|      20|      24|     370|     389|       6
---------------------------------------------------------------------------
  370-  389 (33.36/22.42)	DKVKQLSKYVEPLRRMIAKM
  396-  415 (32.52/21.67)	DKLSKMKKLLEILSNPSKRM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      35.42|      10|     113|     504|     513|       7
---------------------------------------------------------------------------
  504-  513 (20.32/11.48)	PSEIP....DVLQG
  618-  631 (15.09/ 6.63)	PSQIPvtasTVLMG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      66.26|      18|      24|     515|     532|       8
---------------------------------------------------------------------------
  515-  532 (31.75/21.45)	IARLDQRFKVSLDPAQQT
  540-  557 (34.51/24.03)	ICWLDDRHLPCVPPVSVT
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP01491 with Med15 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) LNTKKGTGGTASGAACSGNQGMPDPIGALQTLARQGTGNNQMMNMSGPGSNPQGIIPQPPTNTATNLLQSLNQRPGQPISMQTMQNKIPGMGMMPAQTSGPMNHMGPIQTMQTNSMLTQLNPMAQGNMSQQMNQMVPNQMTQINSGQMQQNMQTQMQSQLSNQINNQITGSISGIQANLPQQMNQIAPGQLGPGQMQQQLSHMQRKQGEMINAGFPGPRNVTPTQFLGQSPSPSAPSPAGLGAPSSNQMVASPALVPSPSPQHAMMAGPQRSVGMAPSPSSSLNTPGGVGATPSPQQEDQAYRDKVKQ
67
374










Molecular Recognition Features






MoRF SequenceStartStop




NANANA