<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01489
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MNRLDDPPSLMKGRKPSFIGMNGGPETDDQQRLRFQVELEFVQCLANPNYLNFLAQRGYFKDSTFINYLKYLLYWKEPEYAKYLKYPMCLYFLDLLQYEHFRREVVNSQCTKFIDDQQILLWQHYTRRRTRLLQTAAEQTQHTNPQNNGIVQPKVP |
Length | 156 |
Position | Middle |
Organism | Apis mellifera (Honeybee) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.14 |
Grand average of hydropathy | -0.717 |
Instability index | 41.18 |
Isoelectric point | 8.94 |
Molecular weight | 18780.26 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP01489
No repeats found
|