<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01483
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MGVTVLQQYPMIENRTGPQTIEFLTKRVVALGAMQTGQFLVDCETYVSVPQLGVQRTLHVLHNSEQPASAFAILESGNKVVPLIADGLFDLLMYKISSVYTNKMQKMESKGPRFEIGDFCVKLGSVTINQNFKGVLVEVEYRPCVVPGSAWELIREFLQGFLGSTVSNQAPQYLQNRMNDIYQPLDTIQQYLEHFGQYRKATGVI |
Length | 205 |
Position | Head |
Organism | Apis mellifera (Honeybee) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.10 |
Grand average of hydropathy | -0.057 |
Instability index | 30.38 |
Isoelectric point | 6.30 |
Molecular weight | 23044.33 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP01483
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.36| 17| 18| 28| 44| 4
---------------------------------------------------------------------------
28- 44 (29.68/19.22) VVALGAMQTGQFLVDCE
49- 65 (29.68/19.22) VPQLGVQRTLHVLHNSE
---------------------------------------------------------------------------
|