<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01483
| Description |
Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MGVTVLQQYPMIENRTGPQTIEFLTKRVVALGAMQTGQFLVDCETYVSVPQLGVQRTLHVLHNSEQPASAFAILESGNKVVPLIADGLFDLLMYKISSVYTNKMQKMESKGPRFEIGDFCVKLGSVTINQNFKGVLVEVEYRPCVVPGSAWELIREFLQGFLGSTVSNQAPQYLQNRMNDIYQPLDTIQQYLEHFGQYRKATGVI |
| Length | 205 |
| Position | Head |
| Organism | Apis mellifera (Honeybee) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.057 |
| Instability index | 30.38 |
| Isoelectric point | 6.30 |
| Molecular weight | 23044.33 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP01483
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.36| 17| 18| 28| 44| 4
---------------------------------------------------------------------------
28- 44 (29.68/19.22) VVALGAMQTGQFLVDCE
49- 65 (29.68/19.22) VPQLGVQRTLHVLHNSE
---------------------------------------------------------------------------
|