<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01477
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MMMGDQFRSKVEQYSPKSSPRGARSPVVSRQDSTGTLKTTISLGKNPSIVHSGPFYLMKEPPGESELTGATNLMNFYGLQHSYSKFSGKKLKEQLSSFLPNLPGIIDRPGHLDNSSLRSVIEKPPIGGKDLIPLTSVQLAGFRLHPGPLPEQYRYVNQAPQRKHKNKHKKHKHKPGEVPSGQEATTTDIGGSDTHEKKHKKQKRHDEEKEARKKRKKEKKRKKQKHSPEHSGGLTPSQHSNS |
| Length | 242 |
| Position | Head |
| Organism | Apis mellifera (Honeybee) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.201 |
| Instability index | 56.87 |
| Isoelectric point | 10.10 |
| Molecular weight | 27115.48 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP01477
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 78.48| 14| 19| 195| 208| 1
---------------------------------------------------------------------------
164- 177 (26.93/ 9.86) HKNKHKKHKHKPGE
195- 208 (27.70/10.30) HEKKHKKQKRHDEE
217- 229 (23.85/ 8.11) KEKKRKKQK.HSPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.23| 22| 34| 102| 124| 3
---------------------------------------------------------------------------
102- 124 (35.70/23.87) LPGIIDRPGHLDNsSLRSVIEKP
139- 160 (41.53/23.73) LAGFRLHPGPLPE.QYRYVNQAP
---------------------------------------------------------------------------
|