<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01462
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MQQREEKQLEASVDSLISLVALTKNALQSFIYKLENEYERLTWPNVLDNFGLLSGQLNTINKMLKNEKTPSFRSQVIIPLVLSQKPDDDLTVLTEQRVPVFSHEIVPDYLRTKPDPEVEEQEKQLSTEAARIGPDVAQKQIQALNKMCSNLLEKLNNPRDDRDAESAASRLNKPSFNPGDTNALVAAVAFGKGLSKCRPPGPMAPGHPGQGPMMSGGPTLQQVTIGGGGGQQAGMGGPVAPQQQGQPGKMPSSIKTNIKSASASMHPYNR |
| Length | 270 |
| Position | Head |
| Organism | Poecilia formosa (Amazon molly) (Limia formosa) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Ovalentaria> Atherinomorphae> Cyprinodontiformes> Poeciliidae> Poeciliinae>
Poecilia.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.572 |
| Instability index | 48.26 |
| Isoelectric point | 7.73 |
| Molecular weight | 29306.97 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP01462
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.89| 10| 19| 201| 218| 1
---------------------------------------------------------------------------
205- 214 (23.90/ 9.47) PGHPGQGPMM
226- 235 (18.99/ 6.45) GGGGGQQAGM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 85.97| 25| 26| 64| 89| 2
---------------------------------------------------------------------------
64- 89 (39.67/30.91) LKNEKTPSFrSQVIIPLVLSQKPDDD
93- 117 (46.29/31.20) LTEQRVPVF.SHEIVPDYLRTKPDPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.14| 19| 19| 161| 179| 3
---------------------------------------------------------------------------
160- 178 (33.27/22.43) DDRDAESAASRLNK...PSFNP
179- 200 (28.87/18.59) GDTNALVAAVAFGKglsKCRPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.75| 18| 102| 133| 151| 4
---------------------------------------------------------------------------
133- 151 (29.28/17.34) GPDVAQKQIQAlNKMCSNL
237- 254 (35.47/17.52) GPVAPQQQGQP.GKMPSSI
---------------------------------------------------------------------------
|