<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01452
Description |
Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MAALAEKSTKERLLSVLDDLEVLSRELIEMLALSRSQKLPQPGEDTQILELLVQRDKEFQELMEVAQQQGKVHQEMQLLEKEVEKRDSDIQQLQKQLKEAEHILATAVYQAKEKLKSIEKARKGSISSEEIIKYAHRISASNAVCAPLNWVPGDPRRPYPTDLEMRSGMLGHMANLSSNGMNGHLPGDALAAGRLPDVLTPHYPWQPSDVSVGMLPPHHGNDFGLEPPGHNKENEDDVEAMSTDSSSSSSDSD |
Length | 253 |
Position | Middle |
Organism | Poecilia formosa (Amazon molly) (Limia formosa) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Ovalentaria> Atherinomorphae> Cyprinodontiformes> Poeciliidae> Poeciliinae>
Poecilia.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.647 |
Instability index | 53.11 |
Isoelectric point | 5.04 |
Molecular weight | 28091.30 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP01452
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.00| 18| 28| 45| 62| 1
---------------------------------------------------------------------------
45- 62 (30.11/23.90) DTQILELLV.QRDKEFQEL
75- 93 (25.89/19.59) EMQLLEKEVeKRDSDIQQL
---------------------------------------------------------------------------
|