Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MTEMFSTLFGQNEAQGPPGSSSLGFGPGKPPPPIPQNQVSMAAQMPPQLVDEGPALRKSGAMNEPFYLLRELPVGNELTGNTNLITHYNLEHAYNKFCGKKVKEKLSNFLPELPGMIDCPGTQDGSSLRSLIDKPPVCGNSFSPLTGASLTGFRLHTGPLPEQYRLMHIQPPKKKSKHKHKHHRPQDPLPQETPSDSEHYPQKEIKHLCNESDKYKYIILTVNEDDKSKKNRHSPDHPGLAGSQPSSNSLR |
Length | 251 |
Position | Head |
Organism | Poecilia formosa (Amazon molly) (Limia formosa) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata> Ovalentaria> Atherinomorphae> Cyprinodontiformes> Poeciliidae> Poeciliinae> Poecilia. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.856 |
Instability index | 55.89 |
Isoelectric point | 8.77 |
Molecular weight | 27770.17 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP01446 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 76.20| 20| 26| 159| 178| 1 --------------------------------------------------------------------------- 159- 178 (38.24/18.45) PLPEQYRLMHIQPPKKKSKH 188- 207 (37.96/18.27) PLPQETPSDSEHYPQKEIKH --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 44.23| 12| 26| 14| 27| 2 --------------------------------------------------------------------------- 14- 27 (20.12/16.59) AQGPPgsSSLGFGP 43- 54 (24.11/12.72) AQMPP..QLVDEGP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 59.94| 18| 21| 109| 128| 3 --------------------------------------------------------------------------- 109- 128 (30.70/23.90) FL..PELPGMIDCPGTqdGSSL 131- 150 (29.25/15.89) LIdkPPVCGNSFSPLT..GASL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KKKSKHKHKH 2) LCNESDKYKYIILTVNEDD 3) QYRLMHIQ | 173 208 163 | 182 226 170 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab