<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01446
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MTEMFSTLFGQNEAQGPPGSSSLGFGPGKPPPPIPQNQVSMAAQMPPQLVDEGPALRKSGAMNEPFYLLRELPVGNELTGNTNLITHYNLEHAYNKFCGKKVKEKLSNFLPELPGMIDCPGTQDGSSLRSLIDKPPVCGNSFSPLTGASLTGFRLHTGPLPEQYRLMHIQPPKKKSKHKHKHHRPQDPLPQETPSDSEHYPQKEIKHLCNESDKYKYIILTVNEDDKSKKNRHSPDHPGLAGSQPSSNSLR |
| Length | 251 |
| Position | Head |
| Organism | Poecilia formosa (Amazon molly) (Limia formosa) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Ovalentaria> Atherinomorphae> Cyprinodontiformes> Poeciliidae> Poeciliinae>
Poecilia.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.856 |
| Instability index | 55.89 |
| Isoelectric point | 8.77 |
| Molecular weight | 27770.17 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP01446
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 76.20| 20| 26| 159| 178| 1
---------------------------------------------------------------------------
159- 178 (38.24/18.45) PLPEQYRLMHIQPPKKKSKH
188- 207 (37.96/18.27) PLPQETPSDSEHYPQKEIKH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.23| 12| 26| 14| 27| 2
---------------------------------------------------------------------------
14- 27 (20.12/16.59) AQGPPgsSSLGFGP
43- 54 (24.11/12.72) AQMPP..QLVDEGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.94| 18| 21| 109| 128| 3
---------------------------------------------------------------------------
109- 128 (30.70/23.90) FL..PELPGMIDCPGTqdGSSL
131- 150 (29.25/15.89) LIdkPPVCGNSFSPLT..GASL
---------------------------------------------------------------------------
|