<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01445
Description |
Uncharacterized protein |
Sequence | MASSMNGMFPGQQPPGAHPVGGPPGPAQPSFPGTAPRVQGNNTLVDELEASFEACFSSLVSQDYVNGTDQEEIRTGVDQCIQKFLDVARQTECFFLQKRLQLSVQKPEQVLKEDVSDLRNELQRKELLVQKHLAKLHHWQQVLEDVSGQHRKPTDLPPPGPLAFLEQASASLPPAPLKPS |
Length | 180 |
Position | Head |
Organism | Poecilia formosa (Amazon molly) (Limia formosa) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Ovalentaria> Atherinomorphae> Cyprinodontiformes> Poeciliidae> Poeciliinae>
Poecilia.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.538 |
Instability index | 50.43 |
Isoelectric point | 5.51 |
Molecular weight | 19767.13 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP01445
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.65| 13| 134| 11| 26| 1
---------------------------------------------------------------------------
11- 26 (26.19/14.97) GQ.QPPGAHPvggPPGP
148- 161 (24.45/ 7.92) GQhRKPTDLP...PPGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.34| 23| 30| 90| 113| 2
---------------------------------------------------------------------------
90- 113 (34.68/24.45) QTECFFLQKRLQlSVQKPEQVLKE
123- 145 (39.67/23.75) QRKELLVQKHLA.KLHHWQQVLED
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.80| 15| 22| 41| 55| 4
---------------------------------------------------------------------------
41- 55 (25.01/16.69) NNTLVDELEASFEAC
66- 80 (26.79/18.26) NGTDQEEIRTGVDQC
---------------------------------------------------------------------------
|