<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01426
Description |
Mediator of RNA polymerase II transcription subunit 25 |
Sequence | MVPGSEGPARAGSVVADVVFVIEGTANLGPYFEGLRKHYLLPAIEYFNGAPQGPPGAASGPPPPGPILRPQNPGANPQLRSLLLNPPPPQTGVPPPQASLHHLQPPGAPALLPPPHQGLGQPQLGPPLLHPPPAQSWPAQLPPRAPLPGQMLLSGGPRGPVPQPGLQPSVMEDDILMDLI |
Length | 180 |
Position | Unknown |
Organism | Homo sapiens (Human) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.234 |
Instability index | 76.01 |
Isoelectric point | 6.16 |
Molecular weight | 18548.22 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP01426
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 154.29| 30| 31| 54| 83| 1
---------------------------------------------------------------------------
54- 83 (62.50/15.45) PPGAASGPPPPGP.ILRP........QNPGANPQLRSLL
86- 112 (46.72/ 9.57) PPPPQTGVPPPQA.SLHH.......lQPPGA.P...ALL
114- 152 (45.07/ 8.95) PPHQGLGQPQLGPpLLHPppaqswpaQLPPRAPLPGQML
---------------------------------------------------------------------------
|
Associated diseases