<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01425
| Description |
Mediator of RNA polymerase II |
| Sequence | MSLLDRPATDPEADTQEVGRQSDVGAELNDIEVSIRKMKSLVDSLDKSATKSKKQMDSRSMLPYNLVLPLDQMDVQMESGDSLRRVDWLVGRNEACRWLRRTNYRTEAIQLSLASCGRFMRNTTLVPLSSGMDLRNLAAPQMSFALIESNSRNPILYVKVGDIMHCLITFGNLCMENIIVRGLDESHYASGHTLRPQTTNPGTFPRISQAMSDLLYSRAISGFSTNLLPNADTMPEGLPPTASQLDLTTPSRHVTFVRVTEVARNALVHFATTTEPPTQLSALHQFCDWLQTYTRLFTEPCVNCDQLLGRDAALPVLRTFHTNPANARAQHEQCRVSTSGFAF |
| Length | 343 |
| Position | Tail |
| Organism | Echinococcus multilocularis (Fox tapeworm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Cestoda>
Eucestoda> Cyclophyllidea> Taeniidae> Echinococcus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.291 |
| Instability index | 57.98 |
| Isoelectric point | 6.45 |
| Molecular weight | 38280.16 |
| Publications | PubMed=23485966
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP01425
No repeats found
|