<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01424
| Description |
Uncharacterized protein (Fragment) |
| Sequence | MPQRPFNAQIRAELRQAEEQIRQRGRAAEVRWSCDKWQQTAL |
| Length | 42 |
| Position | Kinase |
| Organism | Stegodyphus mimosarum |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Araneae>
Araneomorphae> Entelegynae> Eresoidea> Eresidae> Stegodyphus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -1.167 |
| Instability index | 86.61 |
| Isoelectric point | 10.56 |
| Molecular weight | 5053.66 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP01424
No repeats found
No repeats found
|