Description | Mediator of RNA polymerase II transcription subunit 14 (Fragment) |
Sequence | MITVQSDTGVKKVKYTSFFISELAHIVSMCDERIPFSTLCRELNKKDICHNDIQI |
Length | 55 |
Position | Tail |
Organism | Stegodyphus mimosarum |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Araneae> Araneomorphae> Entelegynae> Eresoidea> Eresidae> Stegodyphus. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.042 |
Instability index | 38.82 |
Isoelectric point | 6.70 |
Molecular weight | 6347.34 |
Publications |
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP01422 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) HNDIQI 2) KKVKYTSFFISELAHIV | 50 11 | 55 27 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab