| Description | Mediator of RNA polymerase II transcription subunit 14 (Fragment) |
| Sequence | MITVQSDTGVKKVKYTSFFISELAHIVSMCDERIPFSTLCRELNKKDICHNDIQI |
| Length | 55 |
| Position | Tail |
| Organism | Stegodyphus mimosarum |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Araneae> Araneomorphae> Entelegynae> Eresoidea> Eresidae> Stegodyphus. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.042 |
| Instability index | 38.82 |
| Isoelectric point | 6.70 |
| Molecular weight | 6347.34 |
| Publications |
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats | >MDP01422 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) HNDIQI 2) KKVKYTSFFISELAHIV | 50 11 | 55 27 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab