<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01420
| Description |
Mediator of RNA polymerase II transcription subunit 6 (Fragment) |
| Sequence | GRARVCFPATEGRCSPYRTFKEISKTKAKEEPGSVFQRRRVDVLLTELSKKFPPKLPSPPQLEKQTTEEAVKVEPKVEVKTEKVDTPATTVVATTTTAAATVTAAVLGTTTATTTSATPPPPTTTAAASVVQRTAMKPP |
| Length | 139 |
| Position | Head |
| Organism | Stegodyphus mimosarum |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Araneae>
Araneomorphae> Entelegynae> Eresoidea> Eresidae> Stegodyphus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.433 |
| Instability index | 49.32 |
| Isoelectric point | 9.78 |
| Molecular weight | 14794.82 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP01420
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.57| 17| 26| 86| 102| 2
---------------------------------------------------------------------------
86- 102 (30.87/12.24) TPATTVVAT....TTTAAATV
110- 130 (24.70/ 8.53) TTATTTSATppppTTTAAASV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.25| 10| 18| 46| 55| 3
---------------------------------------------------------------------------
46- 55 (18.41/10.19) TELSKKFPPK
67- 76 (16.84/ 8.78) TEEAVKVEPK
---------------------------------------------------------------------------
|