<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01417
| Description |
Mediator of RNA polymerase II transcription subunit 28 (Fragment) |
| Sequence | MATSANGQIVDDFENSFQACLAALTNPDHFNVRDSEEIKTGVEQTIQRFLDVAKQMECFFLQKRLLLSVQKPEHIILESTNELKSEQRRKQDLIEKYNEKIQTWQNLLQDVPGTPRPPLTAVQPQPPQNIPAIQGPPPQIPSQVVQQGGQSHPHHMMQSHCGPSMTSSPA |
| Length | 170 |
| Position | Head |
| Organism | Stegodyphus mimosarum |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Araneae>
Araneomorphae> Entelegynae> Eresoidea> Eresidae> Stegodyphus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.655 |
| Instability index | 67.62 |
| Isoelectric point | 5.83 |
| Molecular weight | 19098.39 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP01417
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.77| 16| 16| 77| 92| 1
---------------------------------------------------------------------------
77- 92 (26.21/17.83) LESTNE.LKSEQRRKQD
94- 110 (24.56/16.34) IEKYNEkIQTWQNLLQD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.59| 16| 20| 112| 131| 2
---------------------------------------------------------------------------
115- 131 (28.71/18.73) PRP..PLTAVQpQPPQNIP
136- 153 (28.88/ 7.86) PPPqiPSQVVQ.QGGQSHP
---------------------------------------------------------------------------
|