<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01414
| Description |
Mediator of RNA polymerase II transcription subunit 23 (Fragment) |
| Sequence | METVVISAEGKVDRFVEEVLFEGELAVAFHGFIIHTAEDQTKIQKRYQESLKNMFSSFSEDELPPALSHYVKLISSTSSQQKARILFSLLEFGVTNNFVPQRLVCETLLKCDALVYHNEDFWCQSFMLIDKIIAGVDYKGVRDLLKTILDKAHGIKCANNVAVMSQLRAIQKVLETIFDRNTCLLPSYLILDEVQKKIPAKGSYPHWKFSKLISSFVDSFRPTAQMVSVSVFMEIAGDDTAYGKSKLLPVVGHSATLGNVWKLDPVTAKSPLRGLLPYNKELLEPQTSLLRYVLEQPYSRDMVCSMLGLSKQQKQRCPVLEEQLVELIVSAMEKSENETEAMEDGGPTQLLWQ |
| Length | 353 |
| Position | Tail |
| Organism | Stegodyphus mimosarum |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Araneae>
Araneomorphae> Entelegynae> Eresoidea> Eresidae> Stegodyphus.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.079 |
| Instability index | 36.86 |
| Isoelectric point | 5.75 |
| Molecular weight | 39865.69 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP01414
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.23| 13| 17| 270| 282| 3
---------------------------------------------------------------------------
270- 282 (24.38/13.61) SPLRGLL..PYNKEL
288- 302 (19.85/10.06) SLLRYVLeqPYSRDM
---------------------------------------------------------------------------
|