<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01413
Description |
Mediator of RNA polymerase II transcription subunit 23 (Fragment) |
Sequence | MWVLLQFISGSIQKNHLNDFLPVMKLYDLLYPEKEPLPFPDVTKASSTHALAITCIWIHLMKKAQLEQVSLQRRLPPALTAHLEYLQHSLSNNNLSHSLNTDYRISLLCNAYSTNQECFTRPMGVLVEAVQGNPKQQAALTGGAVSGPIKPLSMSILDSLTVHTKMSLIHNIVTHVMKLAQTKSMLCLAPALVETYSRLLVYNEIESLGIKGFISHLLPTVFRSHAWGILHTLLEMFSYRLHHFQP |
Length | 246 |
Position | Tail |
Organism | Stegodyphus mimosarum |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Araneae>
Araneomorphae> Entelegynae> Eresoidea> Eresidae> Stegodyphus.
|
Aromaticity | 0.08 |
Grand average of hydropathy | 0.110 |
Instability index | 41.95 |
Isoelectric point | 8.86 |
Molecular weight | 27733.18 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP01413
No repeats found
|