<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01408
| Description |
Mediator of RNA polymerase II transcription subunit 19 (Fragment) |
| Sequence | MKMGDLRRGDSSYSPKSSPRGSRSPVVPRQDSTGTLKTTISLGRTPSIVHSGPFYLMKEPPKSELTGATNLMSYYNLEHSYNKFCGRKMKDQLSAFLPNLPGNIDGPGNLDNSSLKSLIEKPPIGGKELLPLTGSQLSGFRLHPGPLPEQYRLMSQQPQKKKHKHKKHKHKAGDTPTQESQQDSNLEGPHEKKHKKQKRHDEEKEKKKKKKEKKKKKKHCPDPTTGSSIIPTSGTLP |
| Length | 237 |
| Position | Head |
| Organism | Stegodyphus mimosarum |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Araneae>
Araneomorphae> Entelegynae> Eresoidea> Eresidae> Stegodyphus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.247 |
| Instability index | 63.09 |
| Isoelectric point | 9.98 |
| Molecular weight | 26487.03 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP01408
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 81.66| 24| 28| 145| 171| 1
---------------------------------------------------------------------------
145- 171 (42.85/21.77) GPLPEQyrlMSQQ......PQKKKHKHKKHKHK
173- 202 (38.81/14.06) GDTPTQ...ESQQdsnlegPHEKKHKKQKRHDE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.21| 18| 19| 8| 25| 2
---------------------------------------------------------------------------
8- 25 (33.23/19.23) RGDSSYSPKSSPRGSRSP
29- 46 (30.98/17.45) RQDSTGTLKTTISLGRTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.65| 24| 30| 57| 80| 3
---------------------------------------------------------------------------
50- 78 (37.45/14.94) HS...gpfylMKEPPKSELTG.ATNLMSYYNLE
79- 111 (33.19/12.68) HSynkfcgrkMKDQLSAFLPNlPGNIDGPGNLD
---------------------------------------------------------------------------
|