Description | Mediator of RNA polymerase II transcription subunit 19 (Fragment) |
Sequence | MKMGDLRRGDSSYSPKSSPRGSRSPVVPRQDSTGTLKTTISLGRTPSIVHSGPFYLMKEPPKSELTGATNLMSYYNLEHSYNKFCGRKMKDQLSAFLPNLPGNIDGPGNLDNSSLKSLIEKPPIGGKELLPLTGSQLSGFRLHPGPLPEQYRLMSQQPQKKKHKHKKHKHKAGDTPTQESQQDSNLEGPHEKKHKKQKRHDEEKEKKKKKKEKKKKKKHCPDPTTGSSIIPTSGTLP |
Length | 237 |
Position | Head |
Organism | Stegodyphus mimosarum |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Araneae> Araneomorphae> Entelegynae> Eresoidea> Eresidae> Stegodyphus. |
Aromaticity | 0.04 |
Grand average of hydropathy | -1.247 |
Instability index | 63.09 |
Isoelectric point | 9.98 |
Molecular weight | 26487.03 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP01408 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 81.66| 24| 28| 145| 171| 1 --------------------------------------------------------------------------- 145- 171 (42.85/21.77) GPLPEQyrlMSQQ......PQKKKHKHKKHKHK 173- 202 (38.81/14.06) GDTPTQ...ESQQdsnlegPHEKKHKKQKRHDE --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 64.21| 18| 19| 8| 25| 2 --------------------------------------------------------------------------- 8- 25 (33.23/19.23) RGDSSYSPKSSPRGSRSP 29- 46 (30.98/17.45) RQDSTGTLKTTISLGRTP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 70.65| 24| 30| 57| 80| 3 --------------------------------------------------------------------------- 50- 78 (37.45/14.94) HS...gpfylMKEPPKSELTG.ATNLMSYYNLE 79- 111 (33.19/12.68) HSynkfcgrkMKDQLSAFLPNlPGNIDGPGNLD --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EKKHKKQKRHDEEKEKKKKKKEKKKKKKHCPDPTTGSSIIPTSG 2) HKHKKH | 191 163 | 234 168 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab