<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01405
| Description |
Mediator of RNA polymerase II transcription subunit 12-like protein (Fragment) |
| Sequence | MAVSSWLFEKRPLKRAKLGPPDVYPQDPKQKEDELTAINVKQGFNSSPQIPDEYGSARNSNITATKFGSYFSAVLGLKQELNRFQDSGRKRQQINPKDNFWPVTARSKNAIEAWFKDLAGSKSLTILAKKVPIFNKKEEIFMTLYEFSVPMLRAAWFIKMSSAYIAAISEAKIKKRQLPDPSQEWTQALCKFLREQLTKLAEHHHSSIALGNSSSTGNSSTAALNSSNSSSANSLGSSVTSNSSTGLGSNSLNGVTVDVAYKQWQYCTQLAR |
| Length | 272 |
| Position | Kinase |
| Organism | Stegodyphus mimosarum |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Araneae>
Araneomorphae> Entelegynae> Eresoidea> Eresidae> Stegodyphus.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.508 |
| Instability index | 47.29 |
| Isoelectric point | 9.70 |
| Molecular weight | 30138.73 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP01405
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.24| 19| 22| 206| 226| 1
---------------------------------------------------------------------------
206- 226 (25.00/21.83) SSIALGnSSSTGNSSTaALNS
231- 249 (34.24/19.55) SANSLG.SSVTSNSST.GLGS
---------------------------------------------------------------------------
|