<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01402
| Description |
Mediator of RNA polymerase II transcription subunit 13 (Fragment) |
| Sequence | MTHPNFVTNGASLEDCHTNFFALADLCGIKWRRFYAESVLCIEPLDDPVLSSFSKCLATDILCVWRRVASQGQEQHRHNLQDGNQLNYKKELWVFWYGEEPDLTGLVSSELTADPEHGSWESGLSYECRTLLFKALHNLIERNLLSRGYSRLGKWFVQPYDSSEKTIRR |
| Length | 169 |
| Position | Middle |
| Organism | Stegodyphus mimosarum |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Araneae>
Araneomorphae> Entelegynae> Eresoidea> Eresidae> Stegodyphus.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.432 |
| Instability index | 53.52 |
| Isoelectric point | 5.85 |
| Molecular weight | 19560.83 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP01402
No repeats found
|