<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01398
Description |
Mediator of RNA polymerase II transcription subunit 27-B (Fragment) |
Sequence | MVEAGSVNLDALHSGLKAIKSLRSTVLEVFKFLGDGATAAYGDEEREKFISEVQNLLTNVRSRMRDLETASTLLGSPNSPLTLGNSGLLSQDPAYEKTPLYTELIKSYRWFDKVYEHSNHACAILTQNSLKRSNISPILQAKRIRRPQPSGHNIPPPNVDAVTSQLSRLFSDMQIQVLRPCGSSTVLLISLARTLKALVILRGLIIEWVVVKGYNEDFYTENDKLDMWSGSRYKVFQKVTDHANAAMLHFYSPHLPDLAVRSFMTWLRSYNTLFTSPCRRCGNRLHNNMPPTWRDVRNLDVYHEACRP |
Length | 308 |
Position | Tail |
Organism | Stegodyphus mimosarum |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Araneae>
Araneomorphae> Entelegynae> Eresoidea> Eresidae> Stegodyphus.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.310 |
Instability index | 51.86 |
Isoelectric point | 9.25 |
Molecular weight | 34910.57 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP01398
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.39| 14| 29| 265| 279| 1
---------------------------------------------------------------------------
265- 279 (24.14/20.95) TW..LRSYNtLFTSPCR
292- 307 (23.25/14.51) TWrdVRNLD.VYHEACR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.57| 19| 29| 133| 151| 2
---------------------------------------------------------------------------
133- 151 (32.97/27.84) SNISPILQAKRIRRPQPSG
164- 182 (33.59/28.51) SQLSRLFSDMQIQVLRPCG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 92.97| 30| 199| 28| 64| 3
---------------------------------------------------------------------------
28- 64 (41.98/45.07) EVFKFLGDGATAAYgdeerEKFIS.EVQNLltNVRSRM
234- 264 (50.99/33.82) KVFQKVTDHANAAM.....LHFYSpHLPDL..AVRSFM
---------------------------------------------------------------------------
|