| Description | Mediator of RNA polymerase II transcription subunit 1 (Fragment) |
| Sequence | MFEVMAYSTSHILVSFEHPLEESLATVDLDLRDITNVKCKIYTLSSDATMCTDEYASKIM |
| Length | 60 |
| Position | Middle |
| Organism | Stegodyphus mimosarum |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Araneae> Araneomorphae> Entelegynae> Eresoidea> Eresidae> Stegodyphus. |
| Aromaticity | 0.08 |
| Grand average of hydropathy | 0.110 |
| Instability index | 35.39 |
| Isoelectric point | 4.45 |
| Molecular weight | 6808.73 |
| Publications |
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats | >MDP01395 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) DEYASKIM 2) LDLRDITNVKCKIYTLS | 53 29 | 60 45 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab