Description | Mediator of RNA polymerase II transcription subunit 1 (Fragment) |
Sequence | MFEVMAYSTSHILVSFEHPLEESLATVDLDLRDITNVKCKIYTLSSDATMCTDEYASKIM |
Length | 60 |
Position | Middle |
Organism | Stegodyphus mimosarum |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Araneae> Araneomorphae> Entelegynae> Eresoidea> Eresidae> Stegodyphus. |
Aromaticity | 0.08 |
Grand average of hydropathy | 0.110 |
Instability index | 35.39 |
Isoelectric point | 4.45 |
Molecular weight | 6808.73 |
Publications |
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP01395 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) DEYASKIM 2) LDLRDITNVKCKIYTLS | 53 29 | 60 45 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab