<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01394

Description Mediator of RNA polymerase II transcription subunit 14 (Fragment)
SequenceMVPRPIEGRQTPVVAMQPMAQVMQPAQASNTISLARLIDFILQRTYHELTVLAELLPRKTDMERKIEIVQFASRTRQLFIRLLALAKWAASASKVEKCAAIMAFLDKQSMLFVEMADMLAVMSRETLVNARLPSFHLPCAVEVLTLGTYSRLPTCIRDKIVPPDPITPAEKRSTLLRLNQIIQYRLVSSELPPQMRNLTIENGRVTFHVEHEFEVSLTLMGDGPHVSWRLLDIDILVEDKETGDGEALVHSLQVHYIHQLIQSRLIDNPRPLHELYNCLHSFCQSLQLEVLHSQVLRLCRDRLRDCIVVDEYSAGNRLVISYWRLPKFEENFGEREHFPGRETLSCKLCVQMDPNDPSKPLQVTHVPHLNHKDAQLADQAIKSDFLSVEKLLIHTVHIRTKHKLQELSDILKPLLGLSECTISGSPAVLHIPILQPCMISEELLITVNTHSGHFLAHVPQFEPPMMDDIQNCLNKDPSKIENLISELRFWITVRRCEKTIQHLPALASEHLPLLIPPDHELSKFSKHKLFIKLCKHQEYYIIVRLTENPTNRCEIIPSYYLMTVLPQPLEDDTLEQKVEAVLDTELPKSYLKIMDFASLDNFISTHGPCTEIEYEQQGGSKKRKMITVQSDIGVKKVKYTGFFISELAHIVSMCDERIPFSTLCRELNKKDICHNGIQIEAYGSNYQVKIVQMPTREGSDIETFAALHSALLSCTIRLQGKGSRTWLVEFVFCNCPVTSMSSKEQGPRRPVYYIYDFAAGTSRQVAQMVDDMLQDWNTMGHLYKIVLEFANCLKYDQHNMFSTIMDIKSFTYKKLVLGYGPNKASTVTIYWRPSEKRFHLSFGVVGQTASASNPHTIVAAQLQHEFNQHYSVIALMQVLHDTYSPLLSISKLPSAPELGVIHSRPAVPIQTFVTVPQTSTHLRVIYRN
Length928
PositionTail
OrganismStegodyphus mimosarum
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Araneae> Araneomorphae> Entelegynae> Eresoidea> Eresidae> Stegodyphus.
Aromaticity0.07
Grand average of hydropathy-0.135
Instability index43.87
Isoelectric point6.99
Molecular weight105923.75
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP01394
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     183.85|      48|      52|     389|     438|       1
---------------------------------------------------------------------------
  246-  299 (65.52/42.48)	.EALVHSLQVHYIHQLIQsrLIDNPRPLH.ELYNC.LhsfcqSLQLEVLHSQVLRLC
  389-  437 (77.79/63.61)	EKLLIHTVHIRTKHKLQE..LSDILKPLL.GLSECtI.....SGSPAVLHIPILQPC
  441-  472 (40.53/24.41)	EELLI.TVNTHSGHFLAH..VPQFEPPMMdDIQNC......................
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     171.53|      54|     505|      46|     101|       2
---------------------------------------------------------------------------
   46-  101 (78.58/67.23)	YHELTVLAELLPRKTdMERKIEIVqFASRTRQLFIRLLALAKWAASASKVEKCAAI
  559-  612 (92.94/68.65)	YYLMTVLPQPLEDDT.LEQKVEAV.LDTELPKSYLKIMDFASLDNFISTHGPCTEI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      33.02|       9|     505|     322|     332|       3
---------------------------------------------------------------------------
  322-  332 (12.18/17.18)	YWRlPKfEENF
  830-  838 (20.83/13.18)	YWR.PS.EKRF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      82.01|      25|      97|      14|      42|       5
---------------------------------------------------------------------------
   14-   42 (37.96/38.99)	VAMQPMAQVMqpaqASNTISLARLIDFIL
  113-  137 (44.05/32.35)	VEMADMLAVM....SRETLVNARLPSFHL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP01394 with Med14 domain of Kingdom Metazoa
Unable to open file!