<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01390
Description |
Mediator of RNA polymerase II transcription subunit 18 (Fragment) |
Sequence | MESVTTVRRNFNISPQQEFIMQGSIMDTSCEVLLHRLRGLCDNADEPPETFHDYEMVFQIRGPTGTPMVVKARQALDHPEMPWHLKYSGQPEIGDKNRAALIRSCIDVDTSSNVVQFLNELGFRLEYEYVLKGFMFRKGRMKVMVAKVCRLLQQNNPDSIEPVSQSYLVELTVVAPAGQEAIADEIKAFSE |
Length | 191 |
Position | Head |
Organism | Stegodyphus mimosarum |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Araneae>
Araneomorphae> Entelegynae> Eresoidea> Eresidae> Stegodyphus.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.284 |
Instability index | 46.53 |
Isoelectric point | 5.30 |
Molecular weight | 21713.66 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP01390
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 78.77| 22| 23| 55| 76| 1
---------------------------------------------------------------------------
55- 76 (38.08/25.50) EMVFQIRGPTGTPMVVKARQAL
80- 101 (40.68/27.64) EMPWHLKYSGQPEIGDKNRAAL
---------------------------------------------------------------------------
|