<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01389
| Description |
Transcription elongation factor A protein 2 (Fragment) |
| Sequence | MGCEEEVFKIAKKLDKMVANGAQEQALDLLKALRDLPITLDILQKTRIGMTVNSLRKSTSDDEVITLAKSLIKAWKKLLPGN |
| Length | 82 |
| Position | Unknown |
| Organism | Stegodyphus mimosarum |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Araneae>
Araneomorphae> Entelegynae> Eresoidea> Eresidae> Stegodyphus.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.140 |
| Instability index | 29.92 |
| Isoelectric point | 9.17 |
| Molecular weight | 9109.70 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | translation elongation factor activity GO:0003746 IEA:UniProtKB-KW
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP01389
No repeats found
No repeats found
|