<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01387
| Description |
Uncharacterized protein (Fragment) |
| Sequence | MRLGFLGRLSDLPLSGSMLQQQQGNLDMSVSRGPHGEQNPSSQAGTFTWPASSDLKSSMSASSNHGVGMDTKSHNKENEDVEVMSTDSSSSSSSDSQ |
| Length | 97 |
| Position | Middle |
| Organism | Stegodyphus mimosarum |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Araneae>
Araneomorphae> Entelegynae> Eresoidea> Eresidae> Stegodyphus.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.810 |
| Instability index | 67.21 |
| Isoelectric point | 4.83 |
| Molecular weight | 10250.94 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP01387
No repeats found
No repeats found
|