<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01383
Description |
Mediator of RNA polymerase II transcription subunit 13 (Fragment) |
Sequence | MTTSFDLKNGASLENCHTNFFALADLNGIKWRKFSTDIVSVDILEDPVLLSYSKCIAAGILAVWRRIITQKHIIHQTPQEINSLCCNKELWIFWYEEEPDLSGLISSNLTEIEQGSWESGLSYECRTLLFKAL |
Length | 133 |
Position | Middle |
Organism | Stegodyphus mimosarum |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Araneae>
Araneomorphae> Entelegynae> Eresoidea> Eresidae> Stegodyphus.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.006 |
Instability index | 41.22 |
Isoelectric point | 4.96 |
Molecular weight | 15187.20 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP01383
No repeats found
|