| Description | Mediator of RNA polymerase II transcription subunit 16 (Fragment) |
| Sequence | MPWEAYKVLSHTEDITCVEWDISATKLLIADAVGCIQIWSMKDFLLNDW |
| Length | 49 |
| Position | Tail |
| Organism | Stegodyphus mimosarum |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Araneae> Araneomorphae> Entelegynae> Eresoidea> Eresidae> Stegodyphus. |
| Aromaticity | 0.12 |
| Grand average of hydropathy | 0.237 |
| Instability index | 11.42 |
| Isoelectric point | 4.23 |
| Molecular weight | 5700.54 |
| Publications |
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats | >MDP01381 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) MPWEAYKVL 2) SMKDFLLNDW | 1 40 | 9 49 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab