Description | Mediator of RNA polymerase II transcription subunit 16 (Fragment) |
Sequence | MPWEAYKVLSHTEDITCVEWDISATKLLIADAVGCIQIWSMKDFLLNDW |
Length | 49 |
Position | Tail |
Organism | Stegodyphus mimosarum |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Araneae> Araneomorphae> Entelegynae> Eresoidea> Eresidae> Stegodyphus. |
Aromaticity | 0.12 |
Grand average of hydropathy | 0.237 |
Instability index | 11.42 |
Isoelectric point | 4.23 |
Molecular weight | 5700.54 |
Publications |
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP01381 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) MPWEAYKVL 2) SMKDFLLNDW | 1 40 | 9 49 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab