<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01381
| Description |
Mediator of RNA polymerase II transcription subunit 16 (Fragment) |
| Sequence | MPWEAYKVLSHTEDITCVEWDISATKLLIADAVGCIQIWSMKDFLLNDW |
| Length | 49 |
| Position | Tail |
| Organism | Stegodyphus mimosarum |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Araneae>
Araneomorphae> Entelegynae> Eresoidea> Eresidae> Stegodyphus.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | 0.237 |
| Instability index | 11.42 |
| Isoelectric point | 4.23 |
| Molecular weight | 5700.54 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP01381
No repeats found
No repeats found
|